SLC38A1 anticorps (Middle Region)

N° du produit ABIN630327

Cet anticorps anti-SLC38A1 est un anticorps Lapin Polyclonal détectant SLC38A1 dans WB et IHC. Adapté pour Humain.

Aperçu rapide pour SLC38A1 anticorps (Middle Region) (ABIN630327)

Antigène: SLC38A1 (Solute Carrier Family 38 Member 1 (SLC38A1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC38A1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-SLC38A1 anticorps

Épitope: Middle Region

Specificité: SLC38 A1 antibody was raised against the middle region of SLC38 1

Purification: Purified

Immunogène: SLC38 A1 antibody was raised using the middle region of SLC38 1 corresponding to a region with amino acids LLKNLGYLGYTSGFSLSCMVFFLIVVIYKKFQIPCIVPELNSTISANSTN

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC38A1 Blocking Peptide, (ABIN940542), is also available for use as a blocking control in assays to test for specificity of this SLC38A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC38A1

Antigène: SLC38A1 (Solute Carrier Family 38 Member 1 (SLC38A1))

Autre désignation: SLC38A1

Sujet: Amino acid transporters play essential roles in the uptake of nutrients, production of energy, chemical metabolism, detoxification, and neurotransmitter cycling. SLC38A1 is an important transporter of glutamine, an intermediate in the detoxification of ammonia and the production of urea. Glutamine serves as a precursor for the synaptic transmitter, glutamate.

Poids moléculaire: 54 kDa (MW of target protein)